Anti KCNN4 pAb (ATL-HPA053841)

Atlas Antibodies

Catalog No.:
ATL-HPA053841-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4
Gene Name: KCNN4
Alternative Gene Name: hIKCa1, hKCa4, hSK4, KCa3.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054342: 85%, ENSRNOG00000019440: 85%
Entrez Gene ID: 3783
Uniprot ID: O15554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
Gene Sequence FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
Gene ID - Mouse ENSMUSG00000054342
Gene ID - Rat ENSRNOG00000019440
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCNN4 pAb (ATL-HPA053841)
Datasheet Anti KCNN4 pAb (ATL-HPA053841) Datasheet (External Link)
Vendor Page Anti KCNN4 pAb (ATL-HPA053841) at Atlas Antibodies

Documents & Links for Anti KCNN4 pAb (ATL-HPA053841)
Datasheet Anti KCNN4 pAb (ATL-HPA053841) Datasheet (External Link)
Vendor Page Anti KCNN4 pAb (ATL-HPA053841)
Citations for Anti KCNN4 pAb (ATL-HPA053841) – 1 Found
Rabjerg, Maj; Oliván-Viguera, Aida; Hansen, Lars Koch; Jensen, Line; Sevelsted-Møller, Linda; Walter, Steen; Jensen, Boye L; Marcussen, Niels; Köhler, Ralf. High expression of KCa3.1 in patients with clear cell renal carcinoma predicts high metastatic risk and poor survival. Plos One. 10(4):e0122992.  PubMed