Anti KCNN4 pAb (ATL-HPA053841)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053841-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: KCNN4
Alternative Gene Name: hIKCa1, hKCa4, hSK4, KCa3.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054342: 85%, ENSRNOG00000019440: 85%
Entrez Gene ID: 3783
Uniprot ID: O15554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK |
| Gene Sequence | FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK |
| Gene ID - Mouse | ENSMUSG00000054342 |
| Gene ID - Rat | ENSRNOG00000019440 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KCNN4 pAb (ATL-HPA053841) | |
| Datasheet | Anti KCNN4 pAb (ATL-HPA053841) Datasheet (External Link) |
| Vendor Page | Anti KCNN4 pAb (ATL-HPA053841) at Atlas Antibodies |
| Documents & Links for Anti KCNN4 pAb (ATL-HPA053841) | |
| Datasheet | Anti KCNN4 pAb (ATL-HPA053841) Datasheet (External Link) |
| Vendor Page | Anti KCNN4 pAb (ATL-HPA053841) |
| Citations for Anti KCNN4 pAb (ATL-HPA053841) – 1 Found |
| Rabjerg, Maj; Oliván-Viguera, Aida; Hansen, Lars Koch; Jensen, Line; Sevelsted-Møller, Linda; Walter, Steen; Jensen, Boye L; Marcussen, Niels; Köhler, Ralf. High expression of KCa3.1 in patients with clear cell renal carcinoma predicts high metastatic risk and poor survival. Plos One. 10(4):e0122992. PubMed |