Anti KCNN4 pAb (ATL-HPA053841)

Atlas Antibodies

SKU: ATL-HPA053841-25

• 

Protein Description: potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4
Gene Name: KCNN4
Alternative Gene Name: hIKCa1, hKCa4, hSK4, KCa3.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054342: 85%, ENSRNOG00000019440: 85%
Entrez Gene ID: 3783
Uniprot ID: O15554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
• Gene Sequence: FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
• Gene ID - Mouse: ENSMUSG00000054342
• Gene ID - Rat: ENSRNOG00000019440
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KCNN4 pAb (ATL-HPA053841) – 1 Found

Rabjerg, Maj; Oliván-Viguera, Aida; Hansen, Lars Koch; Jensen, Line; Sevelsted-Møller, Linda; Walter, Steen; Jensen, Boye L; Marcussen, Niels; Köhler, Ralf. High expression of KCa3.1 in patients with clear cell renal carcinoma predicts high metastatic risk and poor survival. Plos One. 10(4):e0122992.