Anti KCNN3 pAb (ATL-HPA057127)

Atlas Antibodies

Catalog No.:
ATL-HPA057127-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 3
Gene Name: KCNN3
Alternative Gene Name: hSK3, KCa2.3, SKCA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000794: 95%, ENSRNOG00000020706: 95%
Entrez Gene ID: 3782
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNATHNHQHAGTTASSTTFPKANKRK
Gene Sequence NLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNATHNHQHAGTTASSTTFPKANKRK
Gene ID - Mouse ENSMUSG00000000794
Gene ID - Rat ENSRNOG00000020706
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCNN3 pAb (ATL-HPA057127)
Datasheet Anti KCNN3 pAb (ATL-HPA057127) Datasheet (External Link)
Vendor Page Anti KCNN3 pAb (ATL-HPA057127) at Atlas Antibodies

Documents & Links for Anti KCNN3 pAb (ATL-HPA057127)
Datasheet Anti KCNN3 pAb (ATL-HPA057127) Datasheet (External Link)
Vendor Page Anti KCNN3 pAb (ATL-HPA057127)