Anti KCNK9 pAb (ATL-HPA075842)

Atlas Antibodies

Catalog No.: ATL-HPA075842-25

Protein Description: potassium two pore domain channel subfamily K member 9
Gene Name: KCNK9
Alternative Gene Name: K2p9.1, TASK-3, TASK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036760: 88%, ENSRNOG00000009265: 88%
Entrez Gene ID: 51305
Uniprot ID: Q9NPC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEP
• Gene Sequence: LESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEP
• Gene ID - Mouse: ENSMUSG00000036760
• Gene ID - Rat: ENSRNOG00000009265
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.