Anti KCNK7 pAb (ATL-HPA077577)

Atlas Antibodies

Catalog No.:
ATL-HPA077577-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: potassium channel, two pore domain subfamily K, member 7
Gene Name: KCNK7
Alternative Gene Name: K2p7.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024936: 75%, ENSRNOG00000020784: 75%
Entrez Gene ID: 10089
Uniprot ID: Q9Y2U2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPPACRLQAELRAELAAFQAEHRACLPPGALEELLGTALATQAHGVSTLGNSSEGRTWDL
Gene Sequence GPPACRLQAELRAELAAFQAEHRACLPPGALEELLGTALATQAHGVSTLGNSSEGRTWDL
Gene ID - Mouse ENSMUSG00000024936
Gene ID - Rat ENSRNOG00000020784
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCNK7 pAb (ATL-HPA077577)
Datasheet Anti KCNK7 pAb (ATL-HPA077577) Datasheet (External Link)
Vendor Page Anti KCNK7 pAb (ATL-HPA077577) at Atlas Antibodies

Documents & Links for Anti KCNK7 pAb (ATL-HPA077577)
Datasheet Anti KCNK7 pAb (ATL-HPA077577) Datasheet (External Link)
Vendor Page Anti KCNK7 pAb (ATL-HPA077577)