Anti KCNJ2 pAb (ATL-HPA029109)

Atlas Antibodies

Catalog No.: ATL-HPA029109-25

Protein Description: potassium inwardly-rectifying channel, subfamily J, member 2
Gene Name: KCNJ2
Alternative Gene Name: IRK1, Kir2.1, LQT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041695: 96%, ENSRNOG00000004720: 98%
Entrez Gene ID: 3759
Uniprot ID: P63252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPES
• Gene Sequence: YEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPES
• Gene ID - Mouse: ENSMUSG00000041695
• Gene ID - Rat: ENSRNOG00000004720
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.