Anti KCNJ15 pAb (ATL-HPA016702)

Atlas Antibodies

Catalog No.: ATL-HPA016702-25

Protein Description: potassium inwardly-rectifying channel, subfamily J, member 15
Gene Name: KCNJ15
Alternative Gene Name: IRKK, Kir1.3, Kir4.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062609: 96%, ENSRNOG00000001656: 96%
Entrez Gene ID: 3772
Uniprot ID: Q99712
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQRERELRTL
• Gene Sequence: SAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQRERELRTL
• Gene ID - Mouse: ENSMUSG00000062609
• Gene ID - Rat: ENSRNOG00000001656
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KCNJ15 pAb (ATL-HPA016702) – 3 Found

Liu, Yang; Wang, Han; Ni, Beibei; Zhang, Jinghua; Li, Shi; Huang, Yuqian; Cai, Yanling; Mei, Hongbing; Li, Zesong. Loss of KCNJ15 expression promotes malignant phenotypes and correlates with poor prognosis in renal carcinoma. Cancer Management And Research. 11( 30799948):1211-1220. 

He, Wenjun; Liu, Wensheng; Chew, Catherine S; Baker, Susan S; Baker, Robert D; Forte, John G; Zhu, Lixin. Acid secretion-associated translocation of KCNJ15 in gastric parietal cells. American Journal Of Physiology. Gastrointestinal And Liver Physiology. 2011;301(4):G591-600. 

Del Rosario, Ricardo C H; Poschmann, Jeremie; Lim, Carey; Cheng, Catherine Y; Kumar, Pavanish; Riou, Catherine; Ong, Seow Theng; Gerges, Sherif; Hajan, Hajira Shreen; Kumar, Dilip; Marzuki, Mardiana; Lu, Xiaohua; Lee, Andrea; Wijaya, Giovani Claresta; Rayan, Nirmala Arul; Zhuang, Zhong; Du Bruyn, Elsa; Chee, Cynthia Bin Eng; Lee, Bernett; Lum, Josephine; Zolezzi, Francesca; Poidinger, Michael; Rotzschke, Olaf; Khor, Chiea Chuen; Wilkinson, Robert J; Wang, Yee T; Chandy, George K; De Libero, Gennaro; Singhal, Amit; Prabhakar, Shyam. Histone acetylome-wide associations in immune cells from individuals with active Mycobacterium tuberculosis infection. Nature Microbiology. 2022;7(2):312-326.