Anti KCNJ12 pAb (ATL-HPA027021)

Atlas Antibodies

Catalog No.:
ATL-HPA027021-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: potassium channel, inwardly rectifying subfamily J, member 12
Gene Name: KCNJ12
Alternative Gene Name: hIRK1, IRK2, KCNJN1, Kir2.2, Kir2.2v
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042529: 79%, ENSRNOG00000002303: 81%
Entrez Gene ID: 3768
Uniprot ID: Q14500
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
Gene Sequence RCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
Gene ID - Mouse ENSMUSG00000042529
Gene ID - Rat ENSRNOG00000002303
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCNJ12 pAb (ATL-HPA027021)
Datasheet Anti KCNJ12 pAb (ATL-HPA027021) Datasheet (External Link)
Vendor Page Anti KCNJ12 pAb (ATL-HPA027021) at Atlas Antibodies

Documents & Links for Anti KCNJ12 pAb (ATL-HPA027021)
Datasheet Anti KCNJ12 pAb (ATL-HPA027021) Datasheet (External Link)
Vendor Page Anti KCNJ12 pAb (ATL-HPA027021)