Anti KCNJ11 pAb (ATL-HPA048891)

Atlas Antibodies

Catalog No.:
ATL-HPA048891-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: potassium inwardly-rectifying channel, subfamily J, member 11
Gene Name: KCNJ11
Alternative Gene Name: BIR, Kir6.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096146: 89%, ENSRNOG00000021128: 91%
Entrez Gene ID: 3767
Uniprot ID: Q14654
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS
Gene Sequence TVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS
Gene ID - Mouse ENSMUSG00000096146
Gene ID - Rat ENSRNOG00000021128
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCNJ11 pAb (ATL-HPA048891)
Datasheet Anti KCNJ11 pAb (ATL-HPA048891) Datasheet (External Link)
Vendor Page Anti KCNJ11 pAb (ATL-HPA048891) at Atlas Antibodies

Documents & Links for Anti KCNJ11 pAb (ATL-HPA048891)
Datasheet Anti KCNJ11 pAb (ATL-HPA048891) Datasheet (External Link)
Vendor Page Anti KCNJ11 pAb (ATL-HPA048891)