Anti KCNJ11 pAb (ATL-HPA048891)

Atlas Antibodies

Catalog No.: ATL-HPA048891-25

Protein Description: potassium inwardly-rectifying channel, subfamily J, member 11
Gene Name: KCNJ11
Alternative Gene Name: BIR, Kir6.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096146: 89%, ENSRNOG00000021128: 91%
Entrez Gene ID: 3767
Uniprot ID: Q14654
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS
• Gene Sequence: TVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS
• Gene ID - Mouse: ENSMUSG00000096146
• Gene ID - Rat: ENSRNOG00000021128
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.