Anti KCNJ1 pAb (ATL-HPA026962 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026962-25

Protein Description: potassium inwardly-rectifying channel, subfamily J, member 1
Gene Name: KCNJ1
Alternative Gene Name: Kir1.1, ROMK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041248: 93%, ENSRNOG00000059005: 94%
Entrez Gene ID: 3758
Uniprot ID: P48048
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETD
• Gene Sequence: STSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETD
• Gene ID - Mouse: ENSMUSG00000041248
• Gene ID - Rat: ENSRNOG00000059005
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KCNJ1 pAb (ATL-HPA026962 w/enhanced validation) – 2 Found

Fukuzawa, Ryuji; Anaka, Matthew R; Morison, Ian M; Reeve, Anthony E. The developmental programme for genesis of the entire kidney is recapitulated in Wilms tumour. Plos One. 12(10):e0186333. 

Vidal-Petiot, Emmanuelle; Elvira-Matelot, Emilie; Mutig, Kerim; Soukaseum, Christelle; Baudrie, Véronique; Wu, Shengnan; Cheval, Lydie; Huc, Elizabeth; Cambillau, Michèle; Bachmann, Sebastian; Doucet, Alain; Jeunemaitre, Xavier; Hadchouel, Juliette. WNK1-related Familial Hyperkalemic Hypertension results from an increased expression of L-WNK1 specifically in the distal nephron. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2013;110(35):14366-71.