Anti KCNIP3 pAb (ATL-HPA069797)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069797-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: KCNIP3
Alternative Gene Name: calsenilin, CSEN, DREAM, KCHIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079056: 94%, ENSRNOG00000014152: 94%
Entrez Gene ID: 30818
Uniprot ID: Q9Y2W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SRQALMRCCLVKWILSSTAPQGSDSSDSELELSTVRHQPEGLDQLQAQTKF |
Gene Sequence | SRQALMRCCLVKWILSSTAPQGSDSSDSELELSTVRHQPEGLDQLQAQTKF |
Gene ID - Mouse | ENSMUSG00000079056 |
Gene ID - Rat | ENSRNOG00000014152 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti KCNIP3 pAb (ATL-HPA069797) | |
Datasheet | Anti KCNIP3 pAb (ATL-HPA069797) Datasheet (External Link) |
Vendor Page | Anti KCNIP3 pAb (ATL-HPA069797) at Atlas Antibodies |
Documents & Links for Anti KCNIP3 pAb (ATL-HPA069797) | |
Datasheet | Anti KCNIP3 pAb (ATL-HPA069797) Datasheet (External Link) |
Vendor Page | Anti KCNIP3 pAb (ATL-HPA069797) |