Anti KCNIP3 pAb (ATL-HPA069797)

Atlas Antibodies

Catalog No.: ATL-HPA069797-25

Protein Description: Kv channel interacting protein 3, calsenilin
Gene Name: KCNIP3
Alternative Gene Name: calsenilin, CSEN, DREAM, KCHIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079056: 94%, ENSRNOG00000014152: 94%
Entrez Gene ID: 30818
Uniprot ID: Q9Y2W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRQALMRCCLVKWILSSTAPQGSDSSDSELELSTVRHQPEGLDQLQAQTKF
• Gene Sequence: SRQALMRCCLVKWILSSTAPQGSDSSDSELELSTVRHQPEGLDQLQAQTKF
• Gene ID - Mouse: ENSMUSG00000079056
• Gene ID - Rat: ENSRNOG00000014152
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.