Anti KCNIP3 pAb (ATL-HPA069797)

Atlas Antibodies

Catalog No.:
ATL-HPA069797-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: Kv channel interacting protein 3, calsenilin
Gene Name: KCNIP3
Alternative Gene Name: calsenilin, CSEN, DREAM, KCHIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079056: 94%, ENSRNOG00000014152: 94%
Entrez Gene ID: 30818
Uniprot ID: Q9Y2W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRQALMRCCLVKWILSSTAPQGSDSSDSELELSTVRHQPEGLDQLQAQTKF
Gene Sequence SRQALMRCCLVKWILSSTAPQGSDSSDSELELSTVRHQPEGLDQLQAQTKF
Gene ID - Mouse ENSMUSG00000079056
Gene ID - Rat ENSRNOG00000014152
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCNIP3 pAb (ATL-HPA069797)
Datasheet Anti KCNIP3 pAb (ATL-HPA069797) Datasheet (External Link)
Vendor Page Anti KCNIP3 pAb (ATL-HPA069797) at Atlas Antibodies

Documents & Links for Anti KCNIP3 pAb (ATL-HPA069797)
Datasheet Anti KCNIP3 pAb (ATL-HPA069797) Datasheet (External Link)
Vendor Page Anti KCNIP3 pAb (ATL-HPA069797)