Anti KCNH8 pAb (ATL-HPA077773)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077773-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: KCNH8
Alternative Gene Name: elk3, Kv12.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035580: 83%, ENSRNOG00000058626: 86%
Entrez Gene ID: 131096
Uniprot ID: Q96L42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RCISPHSDSTLTPLQSISATLSSSVCSSSETSLHLVLPSRSEEGSFSQGTVSSFSLENLPGSWNQEGMASASTKPLENLPLEVVTSTAEVKDNKA |
| Gene Sequence | RCISPHSDSTLTPLQSISATLSSSVCSSSETSLHLVLPSRSEEGSFSQGTVSSFSLENLPGSWNQEGMASASTKPLENLPLEVVTSTAEVKDNKA |
| Gene ID - Mouse | ENSMUSG00000035580 |
| Gene ID - Rat | ENSRNOG00000058626 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KCNH8 pAb (ATL-HPA077773) | |
| Datasheet | Anti KCNH8 pAb (ATL-HPA077773) Datasheet (External Link) |
| Vendor Page | Anti KCNH8 pAb (ATL-HPA077773) at Atlas Antibodies |
| Documents & Links for Anti KCNH8 pAb (ATL-HPA077773) | |
| Datasheet | Anti KCNH8 pAb (ATL-HPA077773) Datasheet (External Link) |
| Vendor Page | Anti KCNH8 pAb (ATL-HPA077773) |