Anti KCNH6 pAb (ATL-HPA061704)

Atlas Antibodies

Catalog No.:
ATL-HPA061704-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: potassium voltage-gated channel subfamily H member 6
Gene Name: KCNH6
Alternative Gene Name: erg2, HERG2, Kv11.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001901: 39%, ENSRNOG00000008078: 34%
Entrez Gene ID: 81033
Uniprot ID: Q9H252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHPDAAPPLSISDASGLWPELLQEMPPRHSPQSPQED
Gene Sequence SGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHPDAAPPLSISDASGLWPELLQEMPPRHSPQSPQED
Gene ID - Mouse ENSMUSG00000001901
Gene ID - Rat ENSRNOG00000008078
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCNH6 pAb (ATL-HPA061704)
Datasheet Anti KCNH6 pAb (ATL-HPA061704) Datasheet (External Link)
Vendor Page Anti KCNH6 pAb (ATL-HPA061704) at Atlas Antibodies

Documents & Links for Anti KCNH6 pAb (ATL-HPA061704)
Datasheet Anti KCNH6 pAb (ATL-HPA061704) Datasheet (External Link)
Vendor Page Anti KCNH6 pAb (ATL-HPA061704)