Anti KCNH3 pAb (ATL-HPA051088)

Atlas Antibodies

Catalog No.:
ATL-HPA051088-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: potassium voltage-gated channel, subfamily H (eag-related), member 3
Gene Name: KCNH3
Alternative Gene Name: BEC1, elk2, Kv12.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037579: 96%, ENSRNOG00000057315: 95%
Entrez Gene ID: 23416
Uniprot ID: Q9ULD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALK
Gene Sequence EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALK
Gene ID - Mouse ENSMUSG00000037579
Gene ID - Rat ENSRNOG00000057315
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCNH3 pAb (ATL-HPA051088)
Datasheet Anti KCNH3 pAb (ATL-HPA051088) Datasheet (External Link)
Vendor Page Anti KCNH3 pAb (ATL-HPA051088) at Atlas Antibodies

Documents & Links for Anti KCNH3 pAb (ATL-HPA051088)
Datasheet Anti KCNH3 pAb (ATL-HPA051088) Datasheet (External Link)
Vendor Page Anti KCNH3 pAb (ATL-HPA051088)