Anti KCNH3 pAb (ATL-HPA051088)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051088-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: KCNH3
Alternative Gene Name: BEC1, elk2, Kv12.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037579: 96%, ENSRNOG00000057315: 95%
Entrez Gene ID: 23416
Uniprot ID: Q9ULD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALK |
| Gene Sequence | EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALK |
| Gene ID - Mouse | ENSMUSG00000037579 |
| Gene ID - Rat | ENSRNOG00000057315 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KCNH3 pAb (ATL-HPA051088) | |
| Datasheet | Anti KCNH3 pAb (ATL-HPA051088) Datasheet (External Link) |
| Vendor Page | Anti KCNH3 pAb (ATL-HPA051088) at Atlas Antibodies |
| Documents & Links for Anti KCNH3 pAb (ATL-HPA051088) | |
| Datasheet | Anti KCNH3 pAb (ATL-HPA051088) Datasheet (External Link) |
| Vendor Page | Anti KCNH3 pAb (ATL-HPA051088) |