Anti KCNH3 pAb (ATL-HPA051088)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051088-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: KCNH3
Alternative Gene Name: BEC1, elk2, Kv12.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037579: 96%, ENSRNOG00000057315: 95%
Entrez Gene ID: 23416
Uniprot ID: Q9ULD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALK |
Gene Sequence | EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALK |
Gene ID - Mouse | ENSMUSG00000037579 |
Gene ID - Rat | ENSRNOG00000057315 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti KCNH3 pAb (ATL-HPA051088) | |
Datasheet | Anti KCNH3 pAb (ATL-HPA051088) Datasheet (External Link) |
Vendor Page | Anti KCNH3 pAb (ATL-HPA051088) at Atlas Antibodies |
Documents & Links for Anti KCNH3 pAb (ATL-HPA051088) | |
Datasheet | Anti KCNH3 pAb (ATL-HPA051088) Datasheet (External Link) |
Vendor Page | Anti KCNH3 pAb (ATL-HPA051088) |