Anti KCNG2 pAb (ATL-HPA048628)

Atlas Antibodies

Catalog No.:
ATL-HPA048628-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: potassium voltage-gated channel, subfamily G, member 2
Gene Name: KCNG2
Alternative Gene Name: KCNF2, Kv6.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059852: 63%, ENSRNOG00000053640: 61%
Entrez Gene ID: 26251
Uniprot ID: Q9UJ96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YSELKEQQQRAASPEPALQEDSTHSATATEDSSQGPDSAGLADDSADALWV
Gene Sequence YSELKEQQQRAASPEPALQEDSTHSATATEDSSQGPDSAGLADDSADALWV
Gene ID - Mouse ENSMUSG00000059852
Gene ID - Rat ENSRNOG00000053640
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCNG2 pAb (ATL-HPA048628)
Datasheet Anti KCNG2 pAb (ATL-HPA048628) Datasheet (External Link)
Vendor Page Anti KCNG2 pAb (ATL-HPA048628) at Atlas Antibodies

Documents & Links for Anti KCNG2 pAb (ATL-HPA048628)
Datasheet Anti KCNG2 pAb (ATL-HPA048628) Datasheet (External Link)
Vendor Page Anti KCNG2 pAb (ATL-HPA048628)