Anti KCNF1 pAb (ATL-HPA014738)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014738-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: KCNF1
Alternative Gene Name: IK8, KCNF, kH1, Kv5.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051726: 89%, ENSRNOG00000024310: 88%
Entrez Gene ID: 3754
Uniprot ID: Q9H3M0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VRYYNKQRVLETAAKHELELMELNSSSGGEGKTGGSRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPLLTEEKHHRTRLQSCK |
| Gene Sequence | VRYYNKQRVLETAAKHELELMELNSSSGGEGKTGGSRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPLLTEEKHHRTRLQSCK |
| Gene ID - Mouse | ENSMUSG00000051726 |
| Gene ID - Rat | ENSRNOG00000024310 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KCNF1 pAb (ATL-HPA014738) | |
| Datasheet | Anti KCNF1 pAb (ATL-HPA014738) Datasheet (External Link) |
| Vendor Page | Anti KCNF1 pAb (ATL-HPA014738) at Atlas Antibodies |
| Documents & Links for Anti KCNF1 pAb (ATL-HPA014738) | |
| Datasheet | Anti KCNF1 pAb (ATL-HPA014738) Datasheet (External Link) |
| Vendor Page | Anti KCNF1 pAb (ATL-HPA014738) |