Anti KCNE4 pAb (ATL-HPA011420 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA011420-25

Protein Description: potassium voltage-gated channel, Isk-related family, member 4
Gene Name: KCNE4
Alternative Gene Name: MiRP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047330: 94%, ENSRNOG00000048478: 94%
Entrez Gene ID: 23704
Uniprot ID: Q8WWG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKKSSLLLLYKDEERLWGEAMKPLPVVSGLRSVQVPLMLNMLQESVAPALSCTLCSMEGDSVSSESSSPDVHLTIQEEGADDELEETSETPLNESSEGSSEN
• Gene Sequence: EKKSSLLLLYKDEERLWGEAMKPLPVVSGLRSVQVPLMLNMLQESVAPALSCTLCSMEGDSVSSESSSPDVHLTIQEEGADDELEETSETPLNESSEGSSEN
• Gene ID - Mouse: ENSMUSG00000047330
• Gene ID - Rat: ENSRNOG00000048478
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KCNE4 pAb (ATL-HPA011420 w/enhanced validation) – 1 Found

Jepps, Thomas A; Carr, Georgina; Lundegaard, Pia R; Olesen, Søren-Peter; Greenwood, Iain A. Fundamental role for the KCNE4 ancillary subunit in Kv7.4 regulation of arterial tone. The Journal Of Physiology. 2015;593(24):5325-40.