Anti KCNE2 pAb (ATL-HPA051553 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA051553-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: potassium voltage-gated channel, Isk-related family, member 2
Gene Name: KCNE2
Alternative Gene Name: LQT6, MiRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039672: 87%, ENSRNOG00000029811: 83%
Entrez Gene ID: 9992
Uniprot ID: Q9Y6J6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMS
Gene Sequence STVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMS
Gene ID - Mouse ENSMUSG00000039672
Gene ID - Rat ENSRNOG00000029811
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCNE2 pAb (ATL-HPA051553 w/enhanced validation)
Datasheet Anti KCNE2 pAb (ATL-HPA051553 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KCNE2 pAb (ATL-HPA051553 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KCNE2 pAb (ATL-HPA051553 w/enhanced validation)
Datasheet Anti KCNE2 pAb (ATL-HPA051553 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KCNE2 pAb (ATL-HPA051553 w/enhanced validation)