Anti KCNAB3 pAb (ATL-HPA077993)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077993-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: KCNAB3
Alternative Gene Name: AKR6A9, KCNA3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018470: 84%, ENSRNOG00000008480: 80%
Entrez Gene ID: 9196
Uniprot ID: O43448
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQ |
| Gene Sequence | CGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQ |
| Gene ID - Mouse | ENSMUSG00000018470 |
| Gene ID - Rat | ENSRNOG00000008480 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KCNAB3 pAb (ATL-HPA077993) | |
| Datasheet | Anti KCNAB3 pAb (ATL-HPA077993) Datasheet (External Link) |
| Vendor Page | Anti KCNAB3 pAb (ATL-HPA077993) at Atlas Antibodies |
| Documents & Links for Anti KCNAB3 pAb (ATL-HPA077993) | |
| Datasheet | Anti KCNAB3 pAb (ATL-HPA077993) Datasheet (External Link) |
| Vendor Page | Anti KCNAB3 pAb (ATL-HPA077993) |