Anti KCNAB3 pAb (ATL-HPA077993)

Atlas Antibodies

Catalog No.: ATL-HPA077993-25

Protein Description: potassium channel, voltage gated subfamily A regulatory beta subunit 3
Gene Name: KCNAB3
Alternative Gene Name: AKR6A9, KCNA3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018470: 84%, ENSRNOG00000008480: 80%
Entrez Gene ID: 9196
Uniprot ID: O43448
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQ
• Gene Sequence: CGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQ
• Gene ID - Mouse: ENSMUSG00000018470
• Gene ID - Rat: ENSRNOG00000008480
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.