Anti KCNA3 pAb (ATL-HPA016625)

Atlas Antibodies

Catalog No.: ATL-HPA016625-25

Protein Description: potassium voltage-gated channel, shaker-related subfamily, member 3
Gene Name: KCNA3
Alternative Gene Name: HLK3, HPCN3, Kv1.3, MK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047959: 99%, ENSRNOG00000062002: 99%
Entrez Gene ID: 3738
Uniprot ID: P22001
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIK
• Gene Sequence: EEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIK
• Gene ID - Mouse: ENSMUSG00000047959
• Gene ID - Rat: ENSRNOG00000062002
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.