Anti KCMF1 pAb (ATL-HPA030384 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030384-25

Protein Description: potassium channel modulatory factor 1
Gene Name: KCMF1
Alternative Gene Name: DEBT91, DKFZP434L1021, PCMF, ZZZ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055239: 99%, ENSRNOG00000015097: 98%
Entrez Gene ID: 56888
Uniprot ID: Q9P0J7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSETERQSMESERADRSLFVQELLLSTLVREESSSSDEDDRGEMADFGAMGCVDIMPLDVALENLNLKESNKGNEPPPPPL
• Gene Sequence: MSETERQSMESERADRSLFVQELLLSTLVREESSSSDEDDRGEMADFGAMGCVDIMPLDVALENLNLKESNKGNEPPPPPL
• Gene ID - Mouse: ENSMUSG00000055239
• Gene ID - Rat: ENSRNOG00000015097
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.