Anti KBTBD8 pAb (ATL-HPA069190)

Atlas Antibodies

Catalog No.:
ATL-HPA069190-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: kelch repeat and BTB (POZ) domain containing 8
Gene Name: KBTBD8
Alternative Gene Name: KIAA1842, TA-KRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030031: 99%, ENSRNOG00000013390: 99%
Entrez Gene ID: 84541
Uniprot ID: Q8NFY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NKWTRKKDFPCDQSINPYLKLVLFQNKLHLFVRATQVTVEEHVFRTSRKNSLYQYDDIADQWMKVYETPDRLWDLGRHFECAVAKLYPQCLQK
Gene Sequence NKWTRKKDFPCDQSINPYLKLVLFQNKLHLFVRATQVTVEEHVFRTSRKNSLYQYDDIADQWMKVYETPDRLWDLGRHFECAVAKLYPQCLQK
Gene ID - Mouse ENSMUSG00000030031
Gene ID - Rat ENSRNOG00000013390
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KBTBD8 pAb (ATL-HPA069190)
Datasheet Anti KBTBD8 pAb (ATL-HPA069190) Datasheet (External Link)
Vendor Page Anti KBTBD8 pAb (ATL-HPA069190) at Atlas Antibodies

Documents & Links for Anti KBTBD8 pAb (ATL-HPA069190)
Datasheet Anti KBTBD8 pAb (ATL-HPA069190) Datasheet (External Link)
Vendor Page Anti KBTBD8 pAb (ATL-HPA069190)