Anti KBTBD13 pAb (ATL-HPA062737)

Atlas Antibodies

Catalog No.:
ATL-HPA062737-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: kelch repeat and BTB (POZ) domain containing 13
Gene Name: KBTBD13
Alternative Gene Name: hCG_1645727, NEM6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054978: 93%, ENSRNOG00000002875: 38%
Entrez Gene ID: 390594
Uniprot ID: C9JR72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEASTLLAGVATLGNKLYIVGGVRGASKEVVELGFCYDPDGGTWHEFPSPHQPRYDTALAGFDGRLYAIG
Gene Sequence LEASTLLAGVATLGNKLYIVGGVRGASKEVVELGFCYDPDGGTWHEFPSPHQPRYDTALAGFDGRLYAIG
Gene ID - Mouse ENSMUSG00000054978
Gene ID - Rat ENSRNOG00000002875
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KBTBD13 pAb (ATL-HPA062737)
Datasheet Anti KBTBD13 pAb (ATL-HPA062737) Datasheet (External Link)
Vendor Page Anti KBTBD13 pAb (ATL-HPA062737) at Atlas Antibodies

Documents & Links for Anti KBTBD13 pAb (ATL-HPA062737)
Datasheet Anti KBTBD13 pAb (ATL-HPA062737) Datasheet (External Link)
Vendor Page Anti KBTBD13 pAb (ATL-HPA062737)