Anti KAT8 pAb (ATL-HPA066324)

Atlas Antibodies

Catalog No.:
ATL-HPA066324-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: K(lysine) acetyltransferase 8
Gene Name: KAT8
Alternative Gene Name: FLJ14040, hMOF, MOF, MYST1, ZC2HC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030801: 100%, ENSRNOG00000019585: 100%
Entrez Gene ID: 84148
Uniprot ID: Q9H7Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHE
Gene Sequence EWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHE
Gene ID - Mouse ENSMUSG00000030801
Gene ID - Rat ENSRNOG00000019585
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KAT8 pAb (ATL-HPA066324)
Datasheet Anti KAT8 pAb (ATL-HPA066324) Datasheet (External Link)
Vendor Page Anti KAT8 pAb (ATL-HPA066324) at Atlas Antibodies

Documents & Links for Anti KAT8 pAb (ATL-HPA066324)
Datasheet Anti KAT8 pAb (ATL-HPA066324) Datasheet (External Link)
Vendor Page Anti KAT8 pAb (ATL-HPA066324)