Anti KAT8 pAb (ATL-HPA066324)

Atlas Antibodies

Catalog No.: ATL-HPA066324-25

Protein Description: K(lysine) acetyltransferase 8
Gene Name: KAT8
Alternative Gene Name: FLJ14040, hMOF, MOF, MYST1, ZC2HC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030801: 100%, ENSRNOG00000019585: 100%
Entrez Gene ID: 84148
Uniprot ID: Q9H7Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHE
• Gene Sequence: EWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHE
• Gene ID - Mouse: ENSMUSG00000030801
• Gene ID - Rat: ENSRNOG00000019585
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.