Anti JMJD4 pAb (ATL-HPA052861)

Atlas Antibodies

Catalog No.:
ATL-HPA052861-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: jumonji domain containing 4
Gene Name: JMJD4
Alternative Gene Name: FLJ12517
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036819: 76%, ENSRNOG00000022438: 79%
Entrez Gene ID: 65094
Uniprot ID: Q9H9V9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVGQAPGRVAFVSEPGAFSYADFVRGFLLPNLPCVFSSAFTQGWGSRRRWVTPAGRPDFDHLLRTYGDVVVPVANCGVQEYNSNPKEHMTLRDYITYWKEYIQAGYSSPRGCLYLKDWHLCRDFPVEDVFTLPVYFSSDWLNEFWDA
Gene Sequence GVGQAPGRVAFVSEPGAFSYADFVRGFLLPNLPCVFSSAFTQGWGSRRRWVTPAGRPDFDHLLRTYGDVVVPVANCGVQEYNSNPKEHMTLRDYITYWKEYIQAGYSSPRGCLYLKDWHLCRDFPVEDVFTLPVYFSSDWLNEFWDA
Gene ID - Mouse ENSMUSG00000036819
Gene ID - Rat ENSRNOG00000022438
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti JMJD4 pAb (ATL-HPA052861)
Datasheet Anti JMJD4 pAb (ATL-HPA052861) Datasheet (External Link)
Vendor Page Anti JMJD4 pAb (ATL-HPA052861) at Atlas Antibodies

Documents & Links for Anti JMJD4 pAb (ATL-HPA052861)
Datasheet Anti JMJD4 pAb (ATL-HPA052861) Datasheet (External Link)
Vendor Page Anti JMJD4 pAb (ATL-HPA052861)