Anti JKAMP pAb (ATL-HPA071650)

Atlas Antibodies

Catalog No.:
ATL-HPA071650-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: JNK1/MAPK8-associated membrane protein
Gene Name: JKAMP
Alternative Gene Name: C14orf100, CDA06, HSPC213, HSPC327, JAMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005078: 90%, ENSRNOG00000004751: 90%
Entrez Gene ID: 51528
Uniprot ID: Q9P055
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TFRRPMAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYD
Gene Sequence TFRRPMAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYD
Gene ID - Mouse ENSMUSG00000005078
Gene ID - Rat ENSRNOG00000004751
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti JKAMP pAb (ATL-HPA071650)
Datasheet Anti JKAMP pAb (ATL-HPA071650) Datasheet (External Link)
Vendor Page Anti JKAMP pAb (ATL-HPA071650) at Atlas Antibodies

Documents & Links for Anti JKAMP pAb (ATL-HPA071650)
Datasheet Anti JKAMP pAb (ATL-HPA071650) Datasheet (External Link)
Vendor Page Anti JKAMP pAb (ATL-HPA071650)