Anti JARID2 pAb (ATL-HPA063889)

Atlas Antibodies

Catalog No.:
ATL-HPA063889-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: jumonji, AT rich interactive domain 2
Gene Name: JARID2
Alternative Gene Name: JMJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038518: 96%, ENSRNOG00000045918: 98%
Entrez Gene ID: 3720
Uniprot ID: Q92833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLQANGTPGLQMLESNVMISPEVLCKEGIKVHRTVQQSGQFVVCFPGSFVSKVCCGYSVSETVHFATTQWTSMGFETAKEMKRR
Gene Sequence LLQANGTPGLQMLESNVMISPEVLCKEGIKVHRTVQQSGQFVVCFPGSFVSKVCCGYSVSETVHFATTQWTSMGFETAKEMKRR
Gene ID - Mouse ENSMUSG00000038518
Gene ID - Rat ENSRNOG00000045918
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti JARID2 pAb (ATL-HPA063889)
Datasheet Anti JARID2 pAb (ATL-HPA063889) Datasheet (External Link)
Vendor Page Anti JARID2 pAb (ATL-HPA063889) at Atlas Antibodies

Documents & Links for Anti JARID2 pAb (ATL-HPA063889)
Datasheet Anti JARID2 pAb (ATL-HPA063889) Datasheet (External Link)
Vendor Page Anti JARID2 pAb (ATL-HPA063889)