Anti JARID2 pAb (ATL-HPA063889)

Atlas Antibodies

Catalog No.: ATL-HPA063889-25

Protein Description: jumonji, AT rich interactive domain 2
Gene Name: JARID2
Alternative Gene Name: JMJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038518: 96%, ENSRNOG00000045918: 98%
Entrez Gene ID: 3720
Uniprot ID: Q92833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLQANGTPGLQMLESNVMISPEVLCKEGIKVHRTVQQSGQFVVCFPGSFVSKVCCGYSVSETVHFATTQWTSMGFETAKEMKRR
• Gene Sequence: LLQANGTPGLQMLESNVMISPEVLCKEGIKVHRTVQQSGQFVVCFPGSFVSKVCCGYSVSETVHFATTQWTSMGFETAKEMKRR
• Gene ID - Mouse: ENSMUSG00000038518
• Gene ID - Rat: ENSRNOG00000045918
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.