Anti JAM2 pAb (ATL-HPA028789)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028789-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: JAM2
Alternative Gene Name: C21orf43, CD322, JAM-B, JAMB, VE-JAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053062: 80%, ENSRNOG00000042848: 80%
Entrez Gene ID: 58494
Uniprot ID: P57087
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVCYAQRKGYFSKETSFQKSNSSSKATTMS |
| Gene Sequence | GVCYAQRKGYFSKETSFQKSNSSSKATTMS |
| Gene ID - Mouse | ENSMUSG00000053062 |
| Gene ID - Rat | ENSRNOG00000042848 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti JAM2 pAb (ATL-HPA028789) | |
| Datasheet | Anti JAM2 pAb (ATL-HPA028789) Datasheet (External Link) |
| Vendor Page | Anti JAM2 pAb (ATL-HPA028789) at Atlas Antibodies |
| Documents & Links for Anti JAM2 pAb (ATL-HPA028789) | |
| Datasheet | Anti JAM2 pAb (ATL-HPA028789) Datasheet (External Link) |
| Vendor Page | Anti JAM2 pAb (ATL-HPA028789) |