Anti JAM2 pAb (ATL-HPA028789)

Atlas Antibodies

Catalog No.:
ATL-HPA028789-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: junctional adhesion molecule 2
Gene Name: JAM2
Alternative Gene Name: C21orf43, CD322, JAM-B, JAMB, VE-JAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053062: 80%, ENSRNOG00000042848: 80%
Entrez Gene ID: 58494
Uniprot ID: P57087
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVCYAQRKGYFSKETSFQKSNSSSKATTMS
Gene Sequence GVCYAQRKGYFSKETSFQKSNSSSKATTMS
Gene ID - Mouse ENSMUSG00000053062
Gene ID - Rat ENSRNOG00000042848
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti JAM2 pAb (ATL-HPA028789)
Datasheet Anti JAM2 pAb (ATL-HPA028789) Datasheet (External Link)
Vendor Page Anti JAM2 pAb (ATL-HPA028789) at Atlas Antibodies

Documents & Links for Anti JAM2 pAb (ATL-HPA028789)
Datasheet Anti JAM2 pAb (ATL-HPA028789) Datasheet (External Link)
Vendor Page Anti JAM2 pAb (ATL-HPA028789)