Anti JAKMIP2 pAb (ATL-HPA065023)

Atlas Antibodies

Catalog No.:
ATL-HPA065023-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: janus kinase and microtubule interacting protein 2
Gene Name: JAKMIP2
Alternative Gene Name: JAMIP2, KIAA0555
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024502: 100%, ENSRNOG00000019159: 99%
Entrez Gene ID: 9832
Uniprot ID: Q96AA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RETEKQCKPLLERNKCLAKRNDELMVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQ
Gene Sequence RETEKQCKPLLERNKCLAKRNDELMVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQ
Gene ID - Mouse ENSMUSG00000024502
Gene ID - Rat ENSRNOG00000019159
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti JAKMIP2 pAb (ATL-HPA065023)
Datasheet Anti JAKMIP2 pAb (ATL-HPA065023) Datasheet (External Link)
Vendor Page Anti JAKMIP2 pAb (ATL-HPA065023) at Atlas Antibodies

Documents & Links for Anti JAKMIP2 pAb (ATL-HPA065023)
Datasheet Anti JAKMIP2 pAb (ATL-HPA065023) Datasheet (External Link)
Vendor Page Anti JAKMIP2 pAb (ATL-HPA065023)