Anti JAK2 pAb (ATL-HPA043870)

Atlas Antibodies

Catalog No.:
ATL-HPA043870-100
Shipping:
Calculated at Checkout
$486.00
Adding to cart… The item has been added
Protein Description: Janus kinase 2
Gene Name: JAK2
Alternative Gene Name: JTK10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024789: 96%, ENSRNOG00000059968: 97%
Entrez Gene ID: 3717
Uniprot ID: O60674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDNIIFQFTKCCPPKPKDKSN
Gene Sequence TGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDNIIFQFTKCCPPKPKDKSN
Gene ID - Mouse ENSMUSG00000024789
Gene ID - Rat ENSRNOG00000059968
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti JAK2 pAb (ATL-HPA043870)
Datasheet Anti JAK2 pAb (ATL-HPA043870) Datasheet (External Link)
Vendor Page Anti JAK2 pAb (ATL-HPA043870) at Atlas Antibodies

Documents & Links for Anti JAK2 pAb (ATL-HPA043870)
Datasheet Anti JAK2 pAb (ATL-HPA043870) Datasheet (External Link)
Vendor Page Anti JAK2 pAb (ATL-HPA043870)