Anti JAK2 pAb (ATL-HPA043870)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043870-100
- Shipping:
- Calculated at Checkout
$486.00
Gene Name: JAK2
Alternative Gene Name: JTK10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024789: 96%, ENSRNOG00000059968: 97%
Entrez Gene ID: 3717
Uniprot ID: O60674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDNIIFQFTKCCPPKPKDKSN |
Gene Sequence | TGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDNIIFQFTKCCPPKPKDKSN |
Gene ID - Mouse | ENSMUSG00000024789 |
Gene ID - Rat | ENSRNOG00000059968 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti JAK2 pAb (ATL-HPA043870) | |
Datasheet | Anti JAK2 pAb (ATL-HPA043870) Datasheet (External Link) |
Vendor Page | Anti JAK2 pAb (ATL-HPA043870) at Atlas Antibodies |
Documents & Links for Anti JAK2 pAb (ATL-HPA043870) | |
Datasheet | Anti JAK2 pAb (ATL-HPA043870) Datasheet (External Link) |
Vendor Page | Anti JAK2 pAb (ATL-HPA043870) |