Anti JADE3 pAb (ATL-HPA064697)

Atlas Antibodies

SKU: ATL-HPA064697-100

• 
• 

Protein Description: jade family PHD finger 3
Gene Name: JADE3
Alternative Gene Name: JADE-3, KIAA0215, PHF16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037315: 75%, ENSRNOG00000039837: 75%
Entrez Gene ID: 9767
Uniprot ID: Q92613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFRKSTVEHFSRSFKETTNRWVKNTEDLQCYVKPTKNMSPKEQFWGRQVLRRSAGRAPYQENDGYCPDLELSDSEAESDGNKE
• Gene Sequence: SFRKSTVEHFSRSFKETTNRWVKNTEDLQCYVKPTKNMSPKEQFWGRQVLRRSAGRAPYQENDGYCPDLELSDSEAESDGNKE
• Gene ID - Mouse: ENSMUSG00000037315
• Gene ID - Rat: ENSRNOG00000039837
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.