Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061866-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: IWS1
Alternative Gene Name: DKFZp761G0123, FLJ10006, FLJ14655, FLJ32319
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024384: 83%, ENSRNOG00000014630: 83%
Entrez Gene ID: 55677
Uniprot ID: Q96ST2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NEELPKPRISDSESEDPPRNQASDSENEELPKPRVSDSESEGPQKGPASDSETEDASRHKQKPESDDDSDRENKGEDTEMQND |
| Gene Sequence | NEELPKPRISDSESEDPPRNQASDSENEELPKPRVSDSESEGPQKGPASDSETEDASRHKQKPESDDDSDRENKGEDTEMQND |
| Gene ID - Mouse | ENSMUSG00000024384 |
| Gene ID - Rat | ENSRNOG00000014630 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation) | |
| Datasheet | Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation) | |
| Datasheet | Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation) |
| Citations for Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation) – 1 Found |
| Orlacchio, Arturo; Stark, Aaron E; Foray, Claudia; Amari, Foued; Sheetz, Tyler; Reese, Erika; Tessari, Anna; La Perle, Krista; Palmieri, Dario; Tsichlis, Philip N; Coppola, Vincenzo. Genetic ablation of interacting with Spt6 (Iws1) causes early embryonic lethality. Plos One. 13(9):e0201030. PubMed |