Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA061866-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: IWS1 homolog (S. cerevisiae)
Gene Name: IWS1
Alternative Gene Name: DKFZp761G0123, FLJ10006, FLJ14655, FLJ32319
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024384: 83%, ENSRNOG00000014630: 83%
Entrez Gene ID: 55677
Uniprot ID: Q96ST2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NEELPKPRISDSESEDPPRNQASDSENEELPKPRVSDSESEGPQKGPASDSETEDASRHKQKPESDDDSDRENKGEDTEMQND
Gene Sequence NEELPKPRISDSESEDPPRNQASDSENEELPKPRVSDSESEGPQKGPASDSETEDASRHKQKPESDDDSDRENKGEDTEMQND
Gene ID - Mouse ENSMUSG00000024384
Gene ID - Rat ENSRNOG00000014630
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation)
Datasheet Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation)
Datasheet Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation)
Citations for Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation) – 1 Found
Orlacchio, Arturo; Stark, Aaron E; Foray, Claudia; Amari, Foued; Sheetz, Tyler; Reese, Erika; Tessari, Anna; La Perle, Krista; Palmieri, Dario; Tsichlis, Philip N; Coppola, Vincenzo. Genetic ablation of interacting with Spt6 (Iws1) causes early embryonic lethality. Plos One. 13(9):e0201030.  PubMed