Anti ITPRIPL2 pAb (ATL-HPA042011)

Atlas Antibodies

Catalog No.:
ATL-HPA042011-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: inositol 1,4,5-trisphosphate receptor interacting protein-like 2
Gene Name: ITPRIPL2
Alternative Gene Name: FLJ22994, LOC162073, MGC126798, MGC126800
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095115: 92%, ENSRNOG00000004956: 24%
Entrez Gene ID: 162073
Uniprot ID: Q3MIP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WLRDCKPFADAFCVDVRGRRHLSATLVLRWFQSHLQRSLATVRYSLEGRCRVTLTPGGLEQPPTLHILPCRTDYGCCRLSMAVRLIPAVH
Gene Sequence WLRDCKPFADAFCVDVRGRRHLSATLVLRWFQSHLQRSLATVRYSLEGRCRVTLTPGGLEQPPTLHILPCRTDYGCCRLSMAVRLIPAVH
Gene ID - Mouse ENSMUSG00000095115
Gene ID - Rat ENSRNOG00000004956
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ITPRIPL2 pAb (ATL-HPA042011)
Datasheet Anti ITPRIPL2 pAb (ATL-HPA042011) Datasheet (External Link)
Vendor Page Anti ITPRIPL2 pAb (ATL-HPA042011) at Atlas Antibodies

Documents & Links for Anti ITPRIPL2 pAb (ATL-HPA042011)
Datasheet Anti ITPRIPL2 pAb (ATL-HPA042011) Datasheet (External Link)
Vendor Page Anti ITPRIPL2 pAb (ATL-HPA042011)