Anti ITPR3 pAb (ATL-HPA003915)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003915-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ITPR3
Alternative Gene Name: IP3R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042644: 86%, ENSRNOG00000052795: 89%
Entrez Gene ID: 3710
Uniprot ID: Q14573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQSSEMGTSVLIMQPILRFLQLLCENHNRD |
| Gene Sequence | ITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQSSEMGTSVLIMQPILRFLQLLCENHNRD |
| Gene ID - Mouse | ENSMUSG00000042644 |
| Gene ID - Rat | ENSRNOG00000052795 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ITPR3 pAb (ATL-HPA003915) | |
| Datasheet | Anti ITPR3 pAb (ATL-HPA003915) Datasheet (External Link) |
| Vendor Page | Anti ITPR3 pAb (ATL-HPA003915) at Atlas Antibodies |
| Documents & Links for Anti ITPR3 pAb (ATL-HPA003915) | |
| Datasheet | Anti ITPR3 pAb (ATL-HPA003915) Datasheet (External Link) |
| Vendor Page | Anti ITPR3 pAb (ATL-HPA003915) |
| Citations for Anti ITPR3 pAb (ATL-HPA003915) – 3 Found |
| Rezuchova, Ingeborg; Hudecova, Sona; Soltysova, Andrea; Matuskova, Miroslava; Durinikova, Erika; Chovancova, Barbora; Zuzcak, Michal; Cihova, Marina; Burikova, Monika; Penesova, Adela; Lencesova, Lubomira; Breza, Jan; Krizanova, Olga. Type 3 inositol 1,4,5-trisphosphate receptor has antiapoptotic and proliferative role in cancer cells. Cell Death & Disease. 2019;10(3):186. PubMed |
| Dos Santos, Marcone Loiola; França, Andressa; Lima Filho, Antônio Carlos Melo; Florentino, Rodrigo M; Diniz, Paulo Henrique; Oliveira Lemos, Fernanda; Gonçalves, Carlos Alberto Xavier; Coelho, Vitor Lima; Lima, Cristiano Xavier; Foureaux, Giselle; Nathanson, Michael H; Vidigal, Paula Vieira Teixeira; Leite, M Fátima. Inositol 1,4,5-trisphosphate receptor type 3 is involved in resistance to apoptosis and maintenance of human hepatocellular carcinoma. Oncology Letters. 2022;23(1):32. PubMed |
| Hartopp, Naomi; Lau, Dawn H W; Martin-Guerrero, Sandra M; Markovinovic, Andrea; Mórotz, Gábor M; Greig, Jenny; Glennon, Elizabeth B; Troakes, Claire; Gomez-Suaga, Patricia; Noble, Wendy; Miller, Christopher C J. Disruption of the VAPB-PTPIP51 ER-mitochondria tethering proteins in post-mortem human amyotrophic lateral sclerosis. Frontiers In Cell And Developmental Biology. 10( 36051435):950767. PubMed |