Anti ITPKC pAb (ATL-HPA050760)

Atlas Antibodies

Catalog No.:
ATL-HPA050760-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: inositol-trisphosphate 3-kinase C
Gene Name: ITPKC
Alternative Gene Name: IP3-3KC, IP3KC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003752: 51%, ENSRNOG00000013945: 55%
Entrez Gene ID: 80271
Uniprot ID: Q96DU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSWADNLWTHQNSSSLQTHPEGACPSKEPSADGSWKELYTDGSRTQQDIEGPWTEPYTDGSQKKQDTEAARKQ
Gene Sequence KSWADNLWTHQNSSSLQTHPEGACPSKEPSADGSWKELYTDGSRTQQDIEGPWTEPYTDGSQKKQDTEAARKQ
Gene ID - Mouse ENSMUSG00000003752
Gene ID - Rat ENSRNOG00000013945
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ITPKC pAb (ATL-HPA050760)
Datasheet Anti ITPKC pAb (ATL-HPA050760) Datasheet (External Link)
Vendor Page Anti ITPKC pAb (ATL-HPA050760) at Atlas Antibodies

Documents & Links for Anti ITPKC pAb (ATL-HPA050760)
Datasheet Anti ITPKC pAb (ATL-HPA050760) Datasheet (External Link)
Vendor Page Anti ITPKC pAb (ATL-HPA050760)