Anti ITPK1 pAb (ATL-HPA055230)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055230-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ITPK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057963: 76%, ENSRNOG00000008051: 76%
Entrez Gene ID: 3705
Uniprot ID: Q13572
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FTDLLNHIATVLQGQSTAMAATGDVALLRHSKLLAEPAGGLVGERTCSASPGCCGSMMGQDAPWKAEADAGGTAKLPHQRLGC |
| Gene Sequence | FTDLLNHIATVLQGQSTAMAATGDVALLRHSKLLAEPAGGLVGERTCSASPGCCGSMMGQDAPWKAEADAGGTAKLPHQRLGC |
| Gene ID - Mouse | ENSMUSG00000057963 |
| Gene ID - Rat | ENSRNOG00000008051 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ITPK1 pAb (ATL-HPA055230) | |
| Datasheet | Anti ITPK1 pAb (ATL-HPA055230) Datasheet (External Link) |
| Vendor Page | Anti ITPK1 pAb (ATL-HPA055230) at Atlas Antibodies |
| Documents & Links for Anti ITPK1 pAb (ATL-HPA055230) | |
| Datasheet | Anti ITPK1 pAb (ATL-HPA055230) Datasheet (External Link) |
| Vendor Page | Anti ITPK1 pAb (ATL-HPA055230) |
| Citations for Anti ITPK1 pAb (ATL-HPA055230) – 1 Found |
| Douanne, Tiphaine; André-Grégoire, Gwennan; Trillet, Kilian; Thys, An; Papin, Antonin; Feyeux, Magalie; Hulin, Philippe; Chiron, David; Gavard, Julie; Bidère, Nicolas. Pannexin-1 limits the production of proinflammatory cytokines during necroptosis. Embo Reports. 2019;20(10):e47840. PubMed |