Anti ITPA pAb (ATL-HPA073963)

Atlas Antibodies

Catalog No.:
ATL-HPA073963-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: inosine triphosphatase
Gene Name: ITPA
Alternative Gene Name: C20orf37, dJ794I6.3, HLC14-06-P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074797: 93%, ENSRNOG00000021233: 96%
Entrez Gene ID: 3704
Uniprot ID: Q9BY32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEAVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQL
Gene Sequence GNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEAVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQL
Gene ID - Mouse ENSMUSG00000074797
Gene ID - Rat ENSRNOG00000021233
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ITPA pAb (ATL-HPA073963)
Datasheet Anti ITPA pAb (ATL-HPA073963) Datasheet (External Link)
Vendor Page Anti ITPA pAb (ATL-HPA073963) at Atlas Antibodies

Documents & Links for Anti ITPA pAb (ATL-HPA073963)
Datasheet Anti ITPA pAb (ATL-HPA073963) Datasheet (External Link)
Vendor Page Anti ITPA pAb (ATL-HPA073963)