Anti ITK pAb (ATL-HPA043670)

Atlas Antibodies

Catalog No.: ATL-HPA043670-25

Protein Description: IL2 inducible T cell kinase
Gene Name: ITK
Alternative Gene Name: EMT, LYK, PSCTK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020395: 89%, ENSRNOG00000006860: 89%
Entrez Gene ID: 3702
Uniprot ID: Q08881
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYN
• Gene Sequence: PTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYN
• Gene ID - Mouse: ENSMUSG00000020395
• Gene ID - Rat: ENSRNOG00000006860
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.