Anti ITK pAb (ATL-HPA043670)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043670-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ITK
Alternative Gene Name: EMT, LYK, PSCTK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020395: 89%, ENSRNOG00000006860: 89%
Entrez Gene ID: 3702
Uniprot ID: Q08881
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYN |
| Gene Sequence | PTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYN |
| Gene ID - Mouse | ENSMUSG00000020395 |
| Gene ID - Rat | ENSRNOG00000006860 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ITK pAb (ATL-HPA043670) | |
| Datasheet | Anti ITK pAb (ATL-HPA043670) Datasheet (External Link) |
| Vendor Page | Anti ITK pAb (ATL-HPA043670) at Atlas Antibodies |
| Documents & Links for Anti ITK pAb (ATL-HPA043670) | |
| Datasheet | Anti ITK pAb (ATL-HPA043670) Datasheet (External Link) |
| Vendor Page | Anti ITK pAb (ATL-HPA043670) |