Anti ITIH2 pAb (ATL-HPA059150)

Atlas Antibodies

Catalog No.:
ATL-HPA059150-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: inter-alpha-trypsin inhibitor heavy chain 2
Gene Name: ITIH2
Alternative Gene Name: H2P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037254: 90%, ENSRNOG00000001066: 90%
Entrez Gene ID: 3698
Uniprot ID: P19823
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPGAKVQFELHYQEVKWRKLGSYEHRIYLQPGRLAKHLEVDVWVIEPQGLRFLHVPDTFEGHFDGVPVISKGQQKAHVSFKPTVAQQRICPNCRET
Gene Sequence LPGAKVQFELHYQEVKWRKLGSYEHRIYLQPGRLAKHLEVDVWVIEPQGLRFLHVPDTFEGHFDGVPVISKGQQKAHVSFKPTVAQQRICPNCRET
Gene ID - Mouse ENSMUSG00000037254
Gene ID - Rat ENSRNOG00000001066
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ITIH2 pAb (ATL-HPA059150)
Datasheet Anti ITIH2 pAb (ATL-HPA059150) Datasheet (External Link)
Vendor Page Anti ITIH2 pAb (ATL-HPA059150) at Atlas Antibodies

Documents & Links for Anti ITIH2 pAb (ATL-HPA059150)
Datasheet Anti ITIH2 pAb (ATL-HPA059150) Datasheet (External Link)
Vendor Page Anti ITIH2 pAb (ATL-HPA059150)
Citations for Anti ITIH2 pAb (ATL-HPA059150) – 2 Found
Chou, C-H; Attarian, D E; Wisniewski, H-G; Band, P A; Kraus, V B. TSG-6 - a double-edged sword for osteoarthritis (OA). Osteoarthritis And Cartilage. 2018;26(2):245-254.  PubMed
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed