Anti ITGB6 pAb (ATL-HPA023626)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023626-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ITGB6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026971: 90%, ENSRNOG00000008346: 88%
Entrez Gene ID: 3694
Uniprot ID: P18564
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RGDCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSI |
| Gene Sequence | RGDCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSI |
| Gene ID - Mouse | ENSMUSG00000026971 |
| Gene ID - Rat | ENSRNOG00000008346 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ITGB6 pAb (ATL-HPA023626) | |
| Datasheet | Anti ITGB6 pAb (ATL-HPA023626) Datasheet (External Link) |
| Vendor Page | Anti ITGB6 pAb (ATL-HPA023626) at Atlas Antibodies |
| Documents & Links for Anti ITGB6 pAb (ATL-HPA023626) | |
| Datasheet | Anti ITGB6 pAb (ATL-HPA023626) Datasheet (External Link) |
| Vendor Page | Anti ITGB6 pAb (ATL-HPA023626) |
| Citations for Anti ITGB6 pAb (ATL-HPA023626) – 4 Found |
| Byström, Sanna; Eklund, Martin; Hong, Mun-Gwan; Fredolini, Claudia; Eriksson, Mikael; Czene, Kamila; Hall, Per; Schwenk, Jochen M; Gabrielson, Marike. Affinity proteomic profiling of plasma for proteins associated to area-based mammographic breast density. Breast Cancer Research : Bcr. 2018;20(1):14. PubMed |
| Kemper, Marius; Schiecke, Alina; Maar, Hanna; Nikulin, Sergey; Poloznikov, Andrey; Galatenko, Vladimir; Tachezy, Michael; Gebauer, Florian; Lange, Tobias; Riecken, Kristoffer; Tonevitsky, Alexander; Aigner, Achim; Izbicki, Jakob; Schumacher, Udo; Wicklein, Daniel. Integrin alpha-V is an important driver in pancreatic adenocarcinoma progression. Journal Of Experimental & Clinical Cancer Research : Cr. 2021;40(1):214. PubMed |
| Wang, Shih-Kai; Choi, Murim; Richardson, Amelia S; Reid, Bryan M; Lin, Brent P; Wang, Susan J; Kim, Jung-Wook; Simmer, James P; Hu, Jan C-C. ITGB6 loss-of-function mutations cause autosomal recessive amelogenesis imperfecta. Human Molecular Genetics. 2014;23(8):2157-63. PubMed |
| Pătru, Adrian; Şurlin, Valeriu; Mărgăritescu, Claudiu; Ciucă, Eduard Mihai; Matei, Marius; Şerbănescu, Mircea Sebastian; Camen, Adrian. Analysis of the distribution and expression of some tumor invasiveness markers in palate squamous cell carcinomas. Romanian Journal Of Morphology And Embryology = Revue Roumaine De Morphologie Et Embryologie. 2020;61(4):1259-1278. PubMed |