Anti ITGB4 pAb (ATL-HPA036349 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036349-100

Protein Description: integrin, beta 4
Gene Name: ITGB4
Alternative Gene Name: CD104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020758: 91%, ENSRNOG00000005580: 92%
Entrez Gene ID: 3691
Uniprot ID: P16144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IVDTVLMAPRSAKPALLKLTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLVEAIDVPAGTATLGRRLVNITIIKEQAR
• Gene Sequence: IVDTVLMAPRSAKPALLKLTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLVEAIDVPAGTATLGRRLVNITIIKEQAR
• Gene ID - Mouse: ENSMUSG00000020758
• Gene ID - Rat: ENSRNOG00000005580
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ITGB4 pAb (ATL-HPA036349 w/enhanced validation) – 1 Found

Arun, Adith S; Tepper, Clifford G; Lam, Kit S. Identification of integrin drug targets for 17 solid tumor types. Oncotarget. 2018;9(53):30146-30162.