Anti ITGB3BP pAb (ATL-HPA028463)

Atlas Antibodies

Catalog No.:
ATL-HPA028463-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: integrin beta 3 binding protein (beta3-endonexin)
Gene Name: ITGB3BP
Alternative Gene Name: CENPR, HSU37139, NRIF3, TAP20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028549: 64%, ENSRNOG00000009116: 60%
Entrez Gene ID: 23421
Uniprot ID: Q13352
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAI
Gene Sequence KVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAI
Gene ID - Mouse ENSMUSG00000028549
Gene ID - Rat ENSRNOG00000009116
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ITGB3BP pAb (ATL-HPA028463)
Datasheet Anti ITGB3BP pAb (ATL-HPA028463) Datasheet (External Link)
Vendor Page Anti ITGB3BP pAb (ATL-HPA028463) at Atlas Antibodies

Documents & Links for Anti ITGB3BP pAb (ATL-HPA028463)
Datasheet Anti ITGB3BP pAb (ATL-HPA028463) Datasheet (External Link)
Vendor Page Anti ITGB3BP pAb (ATL-HPA028463)