Anti ITGB2 pAb (ATL-HPA016894 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA016894-100

Protein Description: integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Gene Name: ITGB2
Alternative Gene Name: CD18, LFA-1, MAC-1, MFI7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000290: 89%, ENSRNOG00000001224: 86%
Entrez Gene ID: 3689
Uniprot ID: P05107
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGV
• Gene Sequence: LEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGV
• Gene ID - Mouse: ENSMUSG00000000290
• Gene ID - Rat: ENSRNOG00000001224
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ITGB2 pAb (ATL-HPA016894 w/enhanced validation) – 2 Found

Vonbrunn, Eva; Ries, Tajana; Söllner, Stefan; Müller-Deile, Janina; Büttner-Herold, Maike; Amann, Kerstin; Daniel, Christoph. Multiplex gene analysis reveals T-cell and antibody-mediated rejection-specific upregulation of complement in renal transplants. Scientific Reports. 2021;11(1):15464. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.