Anti ITGB2 pAb (ATL-HPA008877 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008877-25

Protein Description: integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Gene Name: ITGB2
Alternative Gene Name: CD18, LFA-1, MAC-1, MFI7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000290: 83%, ENSRNOG00000001224: 78%
Entrez Gene ID: 3689
Uniprot ID: P05107
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML
• Gene Sequence: CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML
• Gene ID - Mouse: ENSMUSG00000000290
• Gene ID - Rat: ENSRNOG00000001224
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ITGB2 pAb (ATL-HPA008877 w/enhanced validation) – 1 Found

Liu, He; Wang, Jiao; Luo, Tao; Zhen, Zhiming; Liu, Li; Zheng, Yalan; Zhang, Chaobin; Hu, Xiaofei. Correlation between ITGB2 expression and clinical characterization of glioma and the prognostic significance of its methylation in low-grade glioma(LGG). Frontiers In Endocrinology. 13( 36714574):1106120.