Anti ITGB1BP1 pAb (ATL-HPA071538)

Atlas Antibodies

Catalog No.:
ATL-HPA071538-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: integrin beta 1 binding protein 1
Gene Name: ITGB1BP1
Alternative Gene Name: ICAP-1A, ICAP-1alpha, ICAP-1B, ICAP1, ICAP1A, ICAP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062352: 95%, ENSRNOG00000059402: 95%
Entrez Gene ID: 9270
Uniprot ID: O14713
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEK
Gene Sequence SRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEK
Gene ID - Mouse ENSMUSG00000062352
Gene ID - Rat ENSRNOG00000059402
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ITGB1BP1 pAb (ATL-HPA071538)
Datasheet Anti ITGB1BP1 pAb (ATL-HPA071538) Datasheet (External Link)
Vendor Page Anti ITGB1BP1 pAb (ATL-HPA071538) at Atlas Antibodies

Documents & Links for Anti ITGB1BP1 pAb (ATL-HPA071538)
Datasheet Anti ITGB1BP1 pAb (ATL-HPA071538) Datasheet (External Link)
Vendor Page Anti ITGB1BP1 pAb (ATL-HPA071538)
Citations for Anti ITGB1BP1 pAb (ATL-HPA071538) – 1 Found
Stojic, Lovorka; Lun, Aaron T L; Mascalchi, Patrice; Ernst, Christina; Redmond, Aisling M; Mangei, Jasmin; Barr, Alexis R; Bousgouni, Vicky; Bakal, Chris; Marioni, John C; Odom, Duncan T; Gergely, Fanni. A high-content RNAi screen reveals multiple roles for long noncoding RNAs in cell division. Nature Communications. 2020;11(1):1851.  PubMed