Anti ITGA7 pAb (ATL-HPA008427)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008427-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ITGA7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025348: 94%, ENSRNOG00000007905: 91%
Entrez Gene ID: 3679
Uniprot ID: Q13683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCE |
Gene Sequence | FACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCE |
Gene ID - Mouse | ENSMUSG00000025348 |
Gene ID - Rat | ENSRNOG00000007905 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ITGA7 pAb (ATL-HPA008427) | |
Datasheet | Anti ITGA7 pAb (ATL-HPA008427) Datasheet (External Link) |
Vendor Page | Anti ITGA7 pAb (ATL-HPA008427) at Atlas Antibodies |
Documents & Links for Anti ITGA7 pAb (ATL-HPA008427) | |
Datasheet | Anti ITGA7 pAb (ATL-HPA008427) Datasheet (External Link) |
Vendor Page | Anti ITGA7 pAb (ATL-HPA008427) |
Citations for Anti ITGA7 pAb (ATL-HPA008427) – 1 Found |
Kobayashi, Nobuhiko; Oda, Tsukasa; Takizawa, Makiko; Ishizaki, Takuma; Tsukamoto, Norifumi; Yokohama, Akihiko; Takei, Hisashi; Saitoh, Takayuki; Shimizu, Hiroaki; Honma, Kazuki; Kimura-Masuda, Kei; Kuroda, Yuko; Ishihara, Rei; Murakami, Yuki; Murakami, Hirokazu; Handa, Hiroshi. Integrin α7 and Extracellular Matrix Laminin 211 Interaction Promotes Proliferation of Acute Myeloid Leukemia Cells and Is Associated with Granulocytic Sarcoma. Cancers. 2020;12(2) PubMed |