Anti ITGA6 pAb (ATL-HPA027582 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027582-25

Protein Description: integrin, alpha 6
Gene Name: ITGA6
Alternative Gene Name: CD49f
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027111: 85%, ENSRNOG00000001518: 86%
Entrez Gene ID: 3655
Uniprot ID: P23229
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVINLGKPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQT
• Gene Sequence: RVINLGKPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQT
• Gene ID - Mouse: ENSMUSG00000027111
• Gene ID - Rat: ENSRNOG00000001518
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ITGA6 pAb (ATL-HPA027582 w/enhanced validation) – 1 Found

Wang, Jichang; Zhang, Boxiang; Meng, Jinying; Xiao, Guodong; Li, Xiang; Li, Gang; Qin, Sida; Du, Ning; Zhang, Jia; Zhang, Jing; Xu, Chongwen; Tang, Shou-Ching; Liang, Rui; Ren, Hong; Sun, Xin. Analysis of risk factors for post-operative complications and prognostic predictors of disease recurrence following definitive treatment of patients with esophageal cancer from two medical centers in Northwest China. Experimental And Therapeutic Medicine. 2017;14(3):2584-2594.