Anti ITGA6 pAb (ATL-HPA012696 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA012696-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: integrin, alpha 6
Gene Name: ITGA6
Alternative Gene Name: CD49f
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027111: 88%, ENSRNOG00000001518: 86%
Entrez Gene ID: 3655
Uniprot ID: P23229
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS
Gene Sequence APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS
Gene ID - Mouse ENSMUSG00000027111
Gene ID - Rat ENSRNOG00000001518
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ITGA6 pAb (ATL-HPA012696 w/enhanced validation)
Datasheet Anti ITGA6 pAb (ATL-HPA012696 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ITGA6 pAb (ATL-HPA012696 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ITGA6 pAb (ATL-HPA012696 w/enhanced validation)
Datasheet Anti ITGA6 pAb (ATL-HPA012696 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ITGA6 pAb (ATL-HPA012696 w/enhanced validation)
Citations for Anti ITGA6 pAb (ATL-HPA012696 w/enhanced validation) – 10 Found
Zhang, Dan-Hua; Yang, Zhu-Lin; Zhou, En-Xiang; Miao, Xiong-Ying; Zou, Qiong; Li, Jing-He; Liang, Lu-Feng; Zeng, Gui-Xiang; Chen, Sen-Lin. Overexpression of Thy1 and ITGA6 is associated with invasion, metastasis and poor prognosis in human gallbladder carcinoma. Oncology Letters. 2016;12(6):5136-5144.  PubMed
Timbrell, Simon; Aglan, Hosam; Cramer, Angela; Foden, Phil; Weaver, David; Pachter, Jonathan; Kilgallon, Aoife; Clarke, Robert B; Farnie, Gillian; Bundred, Nigel J. FAK inhibition alone or in combination with adjuvant therapies reduces cancer stem cell activity. Npj Breast Cancer. 2021;7(1):65.  PubMed
Stanzani, Elisabetta; Pedrosa, Leire; Bourmeau, Guillaume; Anezo, Oceane; Noguera-Castells, Aleix; Esteve-Codina, Anna; Passoni, Lorena; Matteoli, Michela; de la Iglesia, Núria; Seano, Giorgio; Martínez-Soler, Fina; Tortosa, Avelina. Dual Role of Integrin Alpha-6 in Glioblastoma: Supporting Stemness in Proneural Stem-Like Cells While Inducing Radioresistance in Mesenchymal Stem-Like Cells. Cancers. 2021;13(12)  PubMed
Krajnak, Slavomir; Jäkel, Jörg; Anić, Katharina; Schwab, Roxana; Schmidt, Marcus; Hasenburg, Annette; Roth, Wilfried; Brenner, Walburgis; Battista, Marco Johannes. Role of integrins in the metastatic spread of high-grade serous ovarian cancer. Archives Of Gynecology And Obstetrics. 2022;305(5):1291-1298.  PubMed
Kielosto, Mari; Nummela, Pirjo; Järvinen, Kristiina; Yin, Miao; Hölttä, Erkki. Identification of integrins alpha6 and beta7 as c-Jun- and transformation-relevant genes in highly invasive fibrosarcoma cells. International Journal Of Cancer. 2009;125(5):1065-73.  PubMed
Sukhdeo, Kumar; Paramban, Rosanto I; Vidal, Jason G; Elia, Jeanne; Martin, Jody; Rivera, Maricruz; Carrasco, Daniel R; Jarrar, Awad; Kalady, Matthew F; Carson, Christian T; Balderas, Robert; Hjelmeland, Anita B; Lathia, Justin D; Rich, Jeremy N. Multiplex flow cytometry barcoding and antibody arrays identify surface antigen profiles of primary and metastatic colon cancer cell lines. Plos One. 8(1):e53015.  PubMed
Schlage, Pascal; Kockmann, Tobias; Sabino, Fabio; Kizhakkedathu, Jayachandran N; Auf dem Keller, Ulrich. Matrix Metalloproteinase 10 Degradomics in Keratinocytes and Epidermal Tissue Identifies Bioactive Substrates With Pleiotropic Functions. Molecular & Cellular Proteomics : Mcp. 2015;14(12):3234-46.  PubMed
Koshizuka, Keiichi; Nohata, Nijiro; Hanazawa, Toyoyuki; Kikkawa, Naoko; Arai, Takayuki; Okato, Atsushi; Fukumoto, Ichiro; Katada, Koji; Okamoto, Yoshitaka; Seki, Naohiko. Deep sequencing-based microRNA expression signatures in head and neck squamous cell carcinoma: dual strands of pre-miR-150 as antitumor miRNAs. Oncotarget. 2017;8(18):30288-30304.  PubMed
Dionísio, Maria Rita; Vieira, André F; Carvalho, Rita; Conde, Inês; Oliveira, Mónica; Gomes, Madalena; Pinto, Marta T; Pereira, Pedro; Pimentel, José; Souza, Cristiano; Marques, Márcia M C; Duval da Silva, Vinícius; Barroso, Alison; Preto, Daniel; Cameselle-Teijeiro, Jorge F; Schmitt, Fernando; Ribeiro, Ana Sofia; Paredes, Joana. BR-BCSC Signature: The Cancer Stem Cell Profile Enriched in Brain Metastases that Predicts a Worse Prognosis in Lymph Node-Positive Breast Cancer. Cells. 2020;9(11)  PubMed
Riivari, Sini; Närvä, Elisa; Kangasniemi, Ilkka; Willberg, Jaana; Närhi, Timo. Epithelial cell attachment and adhesion protein expression on novel in sol TiO(2) coated zirconia and titanium alloy surfaces. Journal Of Biomedical Materials Research. Part B, Applied Biomaterials. 2022;110(11):2533-2541.  PubMed