Anti ITGA5 pAb (ATL-HPA002642 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002642-25

Protein Description: integrin, alpha 5 (fibronectin receptor, alpha polypeptide)
Gene Name: ITGA5
Alternative Gene Name: CD49e, FNRA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000555: 85%, ENSRNOG00000057451: 82%
Entrez Gene ID: 3678
Uniprot ID: P08648
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWA
• Gene Sequence: DQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWA
• Gene ID - Mouse: ENSMUSG00000000555
• Gene ID - Rat: ENSRNOG00000057451
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ITGA5 pAb (ATL-HPA002642 w/enhanced validation) – 4 Found

Puram, Sidharth V; Tirosh, Itay; Parikh, Anuraag S; Patel, Anoop P; Yizhak, Keren; Gillespie, Shawn; Rodman, Christopher; Luo, Christina L; Mroz, Edmund A; Emerick, Kevin S; Deschler, Daniel G; Varvares, Mark A; Mylvaganam, Ravi; Rozenblatt-Rosen, Orit; Rocco, James W; Faquin, William C; Lin, Derrick T; Regev, Aviv; Bernstein, Bradley E. Single-Cell Transcriptomic Analysis of Primary and Metastatic Tumor Ecosystems in Head and Neck Cancer. Cell. 2017;171(7):1611-1624.e24. 

McKenzie, Jodi A; Liu, Tong; Jung, Jae Y; Jones, Benjamin B; Ekiz, Huseyin A; Welm, Alana L; Grossman, Douglas. Survivin promotion of melanoma metastasis requires upregulation of α5 integrin. Carcinogenesis. 2013;34(9):2137-44. 

Kuninty, Praneeth R; Bansal, Ruchi; De Geus, Susanna W L; Mardhian, Deby F; Schnittert, Jonas; van Baarlen, Joop; Storm, Gert; Bijlsma, Maarten F; van Laarhoven, Hanneke W; Metselaar, Josbert M; Kuppen, Peter J K; Vahrmeijer, Alexander L; Östman, Arne; Sier, Cornelis F M; Prakash, Jai. ITGA5 inhibition in pancreatic stellate cells attenuates desmoplasia and potentiates efficacy of chemotherapy in pancreatic cancer. Science Advances. 2019;5(9):eaax2770. 

Lu, Ling; Xie, Ruting; Wei, Rong; Cai, Chunmiao; Bi, Dexi; Yin, Dingzi; Liu, Hu; Zheng, Jiayi; Zhang, Youhua; Song, Feifei; Gao, Yaohui; Tan, Linhua; Wei, Qing; Qin, Huanlong. Integrin α5 subunit is required for the tumor supportive role of fibroblasts in colorectal adenocarcinoma and serves as a potential stroma prognostic marker. Molecular Oncology. 2019;13(12):2697-2714.