Anti ITGA4 pAb (ATL-HPA074961)

Atlas Antibodies

Catalog No.:
ATL-HPA074961-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: integrin subunit alpha 4
Gene Name: ITGA4
Alternative Gene Name: CD49D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027009: 90%, ENSRNOG00000004861: 89%
Entrez Gene ID: 3676
Uniprot ID: P13612
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLLYCIKADPHCLNFLCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKR
Gene Sequence RLLYCIKADPHCLNFLCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKR
Gene ID - Mouse ENSMUSG00000027009
Gene ID - Rat ENSRNOG00000004861
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ITGA4 pAb (ATL-HPA074961)
Datasheet Anti ITGA4 pAb (ATL-HPA074961) Datasheet (External Link)
Vendor Page Anti ITGA4 pAb (ATL-HPA074961) at Atlas Antibodies

Documents & Links for Anti ITGA4 pAb (ATL-HPA074961)
Datasheet Anti ITGA4 pAb (ATL-HPA074961) Datasheet (External Link)
Vendor Page Anti ITGA4 pAb (ATL-HPA074961)