Anti ITGA3 pAb (ATL-HPA008572 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008572-25

Protein Description: integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)
Gene Name: ITGA3
Alternative Gene Name: CD49c, GAP-B3, MSK18, VCA-2, VLA3a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001507: 84%, ENSRNOG00000004276: 82%
Entrez Gene ID: 3675
Uniprot ID: P26006
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGV
• Gene Sequence: AQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGV
• Gene ID - Mouse: ENSMUSG00000001507
• Gene ID - Rat: ENSRNOG00000004276
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ITGA3 pAb (ATL-HPA008572 w/enhanced validation) – 7 Found

Varzavand, Afshin; Hacker, Will; Ma, Deqin; Gibson-Corley, Katherine; Hawayek, Maria; Tayh, Omar J; Brown, James A; Henry, Michael D; Stipp, Christopher S. α3β1 Integrin Suppresses Prostate Cancer Metastasis via Regulation of the Hippo Pathway. Cancer Research. 2016;76(22):6577-6587. 

Sakaguchi, Takashi; Yoshino, Hirofumi; Yonemori, Masaya; Miyamoto, Kazutaka; Sugita, Satoshi; Matsushita, Ryosuke; Itesako, Toshihiko; Tatarano, Shuichi; Nakagawa, Masayuki; Enokida, Hideki. Regulation of ITGA3 by the dual-stranded microRNA-199 family as a potential prognostic marker in bladder cancer. British Journal Of Cancer. 2017;116(8):1077-1087. 

Koshizuka, Keiichi; Hanazawa, Toyoyuki; Kikkawa, Naoko; Arai, Takayuki; Okato, Atsushi; Kurozumi, Akira; Kato, Mayuko; Katada, Koji; Okamoto, Yoshitaka; Seki, Naohiko. Regulation of ITGA3 by the anti-tumor miR-199 family inhibits cancer cell migration and invasion in head and neck cancer. Cancer Science. 2017;108(8):1681-1692. 

Kurozumi, Akira; Goto, Yusuke; Matsushita, Ryosuke; Fukumoto, Ichiro; Kato, Mayuko; Nishikawa, Rika; Sakamoto, Shinichi; Enokida, Hideki; Nakagawa, Masayuki; Ichikawa, Tomohiko; Seki, Naohiko. Tumor-suppressive microRNA-223 inhibits cancer cell migration and invasion by targeting ITGA3/ITGB1 signaling in prostate cancer. Cancer Science. 2016;107(1):84-94. 

Koshizuka, Keiichi; Nohata, Nijiro; Hanazawa, Toyoyuki; Kikkawa, Naoko; Arai, Takayuki; Okato, Atsushi; Fukumoto, Ichiro; Katada, Koji; Okamoto, Yoshitaka; Seki, Naohiko. Deep sequencing-based microRNA expression signatures in head and neck squamous cell carcinoma: dual strands of pre-miR-150 as antitumor miRNAs. Oncotarget. 2017;8(18):30288-30304. 

Idichi, Tetsuya; Seki, Naohiko; Kurahara, Hiroshi; Fukuhisa, Haruhi; Toda, Hiroko; Shimonosono, Masataka; Yamada, Yasutaka; Arai, Takayuki; Kita, Yoshiaki; Kijima, Yuko; Mataki, Yuko; Maemura, Kosei; Natsugoe, Shoji. Involvement of anti-tumor miR-124-3p and its targets in the pathogenesis of pancreatic ductal adenocarcinoma: direct regulation of ITGA3 and ITGB1 by miR-124-3p. Oncotarget. 2018;9(48):28849-28865. 

Li, Qianping; Ma, Weijie; Chen, Shuai; Tian, Eddie C; Wei, Sixi; Fan, Reggie R; Wang, Tao; Zhou, Chihong; Li, Tianhong. High integrin α3 expression is associated with poor prognosis in patients with non-small cell lung cancer. Translational Lung Cancer Research. 2020;9(4):1361-1378.